PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn034361
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 325aa    MW: 35308.7 Da    PI: 6.0596
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn034361genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26037.37.6e-1210615749100
      DUF260  49 lpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                 ++ +  +++++sl+yeA+ r+ +P+yG++g++++++++l+++++e++l++++
  Achn034361 106 IRSKASNTIFRSLLYEACGRIVNPIYGSAGLLWSGNWHLCHAAVEAVLAGSP 157
                 556667899************************************9998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.5E-7105153IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MNRCAYQQIA MEAASDSVVC PKPRRIGLLN PSNDQIRQSL WQINSHRAEI YESKAGSELL  60
DIILSKGFEP SYPRLTIQER EVQSIIAGTH SGNISTYRCI VCPNEIRSKA SNTIFRSLLY  120
EACGRIVNPI YGSAGLLWSG NWHLCHAAVE AVLAGSPIAQ ISPDTAGSAM SPPLKACDIR  180
HLSKDETSSA SRDLRKVRTR GRFKRAGRKP KAEVERAVDE AAQVIWSWSN EKEAVESASH  240
GSVVSQREEP PGHGGGDSDS ASLATVEAKA DERVDGSDVE LELTLGFEPF VRAEKEVDVM  300
KGGEEIDGSE KAPCEVHLVL HCST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002276899.17e-64PREDICTED: LOB domain-containing protein 41
TrEMBLA0A068TQW52e-69A0A068TQW5_COFCA; Uncharacterized protein
STRINGVIT_17s0000g03720.t012e-63(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8862494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02550.12e-39LOB domain-containing protein 41